5xop/1/1:F/1:B

Sequences
>5xop-a1-m1-cF (length=65) [Search sequence]
MAEALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDKDGDGFIDFEEFAK
FYGSI
>5xop-a1-m1-cB (length=66) [Search sequence]
MAEALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDKDGDGFIDFEEFAK
FYGSIA
Structure information
PDB ID 5xop (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of N-terminal domain EhCaBP1 EF-2 mutant
Assembly ID 1
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 14
Sequence identity between the two chains 1.0
PubMed citation 17554780
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID F B
UniProt accession M3TKH6 M3TKH6
Species 885319 (Entamoeba histolytica HM-1:IMSS-B) 885319 (Entamoeba histolytica HM-1:IMSS-B)
Function annotation BioLiP:5xopF BioLiP:5xopB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5xop-a1-m1-cF_5xop-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 5xop-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 2nxq/3/2:A/3:A 2nxq/1/1:A/2:A 2nxq/1/1:A/3:A 2nxq/1/2:A/3:A 2nxq/2/1:B/2:B 2nxq/2/1:B/3:B 2nxq/2/2:B/3:B 2nxq/3/1:A/2:A 2nxq/3/1:A/3:A 2nxq/3/1:B/2:B 2nxq/3/1:B/3:B 2nxq/3/2:B/3:B 3li6/1/1:A/2:A 3li6/1/1:A/3:A 3li6/1/2:A/3:A 3li6/2/1:D/4:D 3li6/2/1:D/5:D 3li6/2/4:D/5:D 3li6/3/1:G/4:G 3li6/3/1:G/5:G 3li6/3/4:G/5:G 3li6/4/1:J/2:J 3li6/4/1:J/3:J 3li6/4/2:J/3:J 3px1/1/1:A/2:A 3px1/1/1:A/3:A 3px1/1/2:A/3:A 3px1/2/1:B/2:B 3px1/2/1:B/3:B 3px1/2/2:B/3:B 3qjk/1/1:A/2:A 3qjk/1/1:A/3:A 3qjk/1/2:A/3:A 3qjk/2/1:B/2:B 3qjk/2/1:B/3:B 3qjk/2/2:B/3:B 3ulg/1/1:A/2:A 3ulg/1/1:A/3:A 3ulg/1/2:A/3:A 3ulg/2/1:B/2:B 3ulg/2/1:B/3:B 3ulg/2/2:B/3:B 5xop/1/1:A/1:B 5xop/1/1:A/1:C 5xop/1/1:B/1:C 5xop/1/1:D/1:E 5xop/1/1:F/1:D 5xop/1/1:F/1:E
    		•

    [Back to Home]