5xor/2/1:C/1:B

Sequences

>5xor-a2-m1-cC (length=99) [Search sequence]

PQPHKRWVFTLNNPSEDERKKIRDLPISLFDYFIVGEEGNRTPHLQGFANFVKKQTFNKV KWYLGARCHIEKAKGTDQQNKEYCSKEGNLLIECGAPRS

>5xor-a2-m1-cB (length=101) [Search sequence]

QPHKRWVFTLNNPSEDERKKIRDLPISLFDYFIVGEEGNEEGRTPHLQGFANFVKKQTFN KVKWYLGARCHIEKAKGTDQQNKEYCSKEGNLLIECGAPRS

Structure information

PDB ID	5xor (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of N-terminal replicase protein of porcine circovirus type 2
Assembly ID	2
Resolution	2.699Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	42
Sequence identity between the two chains	0.99

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	B
UniProt accession	A9YPG7	A9YPG7
Species	85708 (Porcine circovirus 2)	85708 (Porcine circovirus 2)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5xor-a2-m1-cC_5xor-a2-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5xor-assembly2.cif.gz

Similar dimers