5xqr/1/1:B/1:A

Sequences
>5xqr-a1-m1-cB (length=61) [Search sequence]
GESVVATQLIPINTALTPVMMEGKVTNPSGIPFAEMSQIVGKQVNTPVAKGQTLMPGMVK
T
>5xqr-a1-m1-cA (length=64) [Search sequence]
GESVVATQLIPINTALTPVMMEGKVTNPSGIPFAEMSQIVGKQVNTPVAKGQTLMPGMVK
TYVP
Structure information
PDB ID 5xqr (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of Notched-fin eelpout type III antifreeze protein A20V mutant (NFE6, AFP), C2221 form
Assembly ID 1
Resolution 1.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 23
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession Q53UJ4 Q53UJ4
Species 291231 (Zoarces elongatus) 291231 (Zoarces elongatus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5xqr-a1-m1-cB_5xqr-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 5xqr-assembly1.cif.gz

[Back to Home]