5xuk/1/2:A/3:A

Sequences
>5xuk-a1-m2-cA (length=115) [Search sequence]
MIGIDIVSIARIEKCVKRFKMKFLERFLSPSEIVLCKDKSSSIAGFFALKEACSKALQVG
IGKELSFLDIKISKSPKNAPLITLSKEKMDYFNIQSLSASISHDAGFAIAVVVVS
>5xuk-a1-m3-cA (length=115) [Search sequence]
MIGIDIVSIARIEKCVKRFKMKFLERFLSPSEIVLCKDKSSSIAGFFALKEACSKALQVG
IGKELSFLDIKISKSPKNAPLITLSKEKMDYFNIQSLSASISHDAGFAIAVVVVS
Structure information
PDB ID 5xuk (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of Helicobacter pylori holo-[acyl-carrier-protein] synthase (AcpS) in complex with coenzyme A
Assembly ID 1
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 50
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID A A
UniProt accession O25488 O25488
Species 85962 (Helicobacter pylori 26695) 85962 (Helicobacter pylori 26695)
Function annotation BioLiP:5xukA BioLiP:5xukA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5xuk-a1-m2-cA_5xuk-a1-m3-cA.pdb.gz
Full biological assembly
Download: 5xuk-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5xuk/1/1:A/2:A 5xuk/1/1:A/3:A

[Back to Home]