5xwe/1/1:B/1:A

Sequences
>5xwe-a1-m1-cB (length=50) [Search sequence]
RICLKQETTTCPEGEDACYNLFWKIEMGCGCPKTEPYTNLYCCKIDSCNK
>5xwe-a1-m1-cA (length=51) [Search sequence]
RICLKQETTTTCPEGEDACYNLFWKIEMGCGCPKTEPYTNLYCCKIDSCNK
Structure information
PDB ID 5xwe (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of a three finger toxin from Ophiophagus hannah venom
Assembly ID 1
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 30
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession Q69CJ8 Q69CJ8
Species 8665 (Ophiophagus hannah) 8665 (Ophiophagus hannah)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5xwe-a1-m1-cB_5xwe-a1-m1-cA.pdb.gz
Full biological assembly
Download: 5xwe-assembly1.cif.gz

[Back to Home]