5xyv/1/1:A/1:B

Sequences
>5xyv-a1-m1-cA (length=63) [Search sequence]
PFGVNRGLDLDKILHCYQMNDDLFMFVTWKGCSSIDAVHINDIKEAYPLQIIKYFESLRI
IVP
>5xyv-a1-m1-cB (length=64) [Search sequence]
KPFGVNRGLDLDKILHCYQMNDDLFMFVTWKGCSSIDAVHINDIKEAYPLQIIKYFESLR
IIVP
Structure information
PDB ID 5xyv (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of drosophila melanogaster Rhino chromoshadow domain in complex with Deadlock N-terminal domain
Assembly ID 1
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 39
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q7JXA8 Q7JXA8
Species 7227 (Drosophila melanogaster) 7227 (Drosophila melanogaster)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5xyv-a1-m1-cA_5xyv-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 5xyv-assembly1.cif.gz

[Back to Home]