5xyw/1/1:B/1:A

Sequences

>5xyw-a1-m1-cB (length=42) [Search sequence]

LDKVLHCYQMKELFLFVTWSIDAVPMKYIREAYPLQVIEFFQ

>5xyw-a1-m1-cA (length=54) [Search sequence]

GLDRGLELDKVLHCYQMKELFLFVTWKGCSSIDAVPMKYIREAYPLQVIEFFQS

Structure information

PDB ID	5xyw (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of drosophila simulans Rhino chromoshadow domain in complex with N-terminal domain
Assembly ID	1
Resolution	2.705Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	28
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	Q49BI5	Q49BI5
Species	7240 (Drosophila simulans)	7240 (Drosophila simulans)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 5xyw-a1-m1-cB_5xyw-a1-m1-cA.pdb.gz

Full biological assembly Download: 5xyw-assembly1.cif.gz