5xyw/1/1:B/1:A

Sequences
>5xyw-a1-m1-cB (length=42) [Search sequence]
LDKVLHCYQMKELFLFVTWSIDAVPMKYIREAYPLQVIEFFQ
>5xyw-a1-m1-cA (length=54) [Search sequence]
GLDRGLELDKVLHCYQMKELFLFVTWKGCSSIDAVPMKYIREAYPLQVIEFFQS
Structure information
PDB ID 5xyw (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of drosophila simulans Rhino chromoshadow domain in complex with N-terminal domain
Assembly ID 1
Resolution 2.705Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 28
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession Q49BI5 Q49BI5
Species 7240 (Drosophila simulans) 7240 (Drosophila simulans)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5xyw-a1-m1-cB_5xyw-a1-m1-cA.pdb.gz
Full biological assembly
Download: 5xyw-assembly1.cif.gz

[Back to Home]