5y3b/1/1:D/1:G

Sequences
>5y3b-a1-m1-cD (length=81) [Search sequence]
TCTKVLYFTDRSLTPFMVNIPKRLGEVTLKDFKAAIDREGNHRYHFKALDPEFGTVKEEV
FHDDDAIPGWEGKIVAWVEED
>5y3b-a1-m1-cG (length=82) [Search sequence]
STCTKVLYFTDRSLTPFMVNIPKRLGEVTLKDFKAAIDREGNHRYHFKALDPEFGTVKEE
VFHDDDAIPGWEGKIVAWVEED
Structure information
PDB ID 5y3b (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of mouse Ccd1 DIX domain
Assembly ID 1
Resolution 3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 12
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D G
UniProt accession Q80Y83 Q80Y83
Species 10090 (Mus musculus) 10090 (Mus musculus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5y3b-a1-m1-cD_5y3b-a1-m1-cG.pdb.gz
Full biological assembly
Download: 5y3b-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5y3b/1/1:A/1:E 5y3b/1/1:G/1:C
Other dimers with similar sequences but different poses
  • 5y3b/1/1:B/1:A 5y3b/1/1:B/1:C 5y3b/1/1:D/1:C 5y3b/1/1:E/1:F 5y3b/1/1:G/1:F
  • [Back to Home]