5y6o/3/1:H/1:G

Sequences
>5y6o-a3-m1-cH (length=103) [Search sequence]
KCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRA
RSRPAKLYVYINELCTVLKAHSAKDPENRIAKKMLLEEIKANL
>5y6o-a3-m1-cG (length=105) [Search sequence]
KCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRA
RSRPAKLYVYINELCTVLKAHSAKKDPENRIAKKMLLEEIKANLS
Structure information
PDB ID 5y6o (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of DAXX N-terminal four-helix bundle domain (4HB) in complex with ATRX
Assembly ID 3
Resolution 3.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 41
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID H G
UniProt accession P46100 P46100
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5y6o-a3-m1-cH_5y6o-a3-m1-cG.pdb.gz
Full biological assembly
Download: 5y6o-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5y6o/1/1:A/1:B 5y6o/1/1:B/1:C 5y6o/2/1:D/1:E 5y6o/2/1:F/1:E 5y6o/3/1:H/1:I
Other dimers with similar sequences but different poses
  • 5y6o/3/1:I/1:G 5y6o/1/1:A/1:C 5y6o/2/1:F/1:D
  • [Back to Home]