5ycs/1/1:C/1:D

Sequences

>5ycs-a1-m1-cC (length=256) [Search sequence]

MELLQGKTFVVMGVANQRSIAWGIARSLHNAGAKLIFTYAGERLERNVRELADTLEGQES
LVLPCDVTNDEELTACFETIKQEVGTIHGVAHCIAFANRDDLKGEFVDTSRDGFLLAQNI
SAFSLTAVAREAKKVMTEGGNILTLTYLGGERVVKNYNVMGVAKASLEASVKYLANDLGQ
HGIRVNAISAGPIRTLSAKGVGDFNSILREIEERAPLRRTTTQEEVGDTAVFLFSDLARG
VTGENIHVDSGYHILG

>5ycs-a1-m1-cD (length=256) [Search sequence]

Structure information

PDB ID	5ycs (database links: RCSB PDB PDBe PDBj PDBsum)
Title	X-Ray Structure of Enoyl-Acyl Carrier Protein Reductase from Bacillus Anthracis with triclosan
Assembly ID	1
Resolution	1.95Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	102
Sequence identity between the two chains	1.0
PubMed citation	28935372

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	Q81GI3	Q81GI3
Species	226900 (Bacillus cereus ATCC 14579)	226900 (Bacillus cereus ATCC 14579)
Function annotation	BioLiP:5ycsC	BioLiP:5ycsD

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	5ycs-a1-m1-cC_5ycs-a1-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	5ycs-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	2qio/1/1:A/1:B 2qio/1/1:C/1:D 3ojf/1/1:B/1:C 3ojf/1/1:D/1:A 5ycr/1/1:A/1:C 5ycr/1/1:D/1:B 5ycs/1/1:A/1:B 5ycv/1/1:B/1:C 5ycv/1/1:D/1:A
Other dimers with similar sequences but different poses	5ycs/1/1:B/1:D 2qio/1/1:A/1:C 2qio/1/1:B/1:D 3ojf/1/1:B/1:D 3ojf/1/1:C/1:A 5ycr/1/1:B/1:C 5ycr/1/1:D/1:A 5ycs/1/1:A/1:C 5ycv/1/1:B/1:A 5ycv/1/1:D/1:C 5ycs/1/1:A/1:D 2qio/1/1:A/1:D 2qio/1/1:B/1:C 3ojf/1/1:B/1:A 3ojf/1/1:C/1:D 5ycr/1/1:A/1:B 5ycr/1/1:D/1:C 5ycs/1/1:B/1:C 5ycv/1/1:A/1:C 5ycv/1/1:B/1:D