5ypp/2/1:C/1:D

Sequences
>5ypp-a2-m1-cC (length=90) [Search sequence]
DNVILELTVRNHPGVMTHVCGLFARRAFNVEGILCLPIQDSDKSHIWLLVNDDQRLEQMI
SQIDKLEDVVKVQRNQSDPTMFNKIAVFFQ
>5ypp-a2-m1-cD (length=90) [Search sequence]
DNVILELTVRNHPGVMTHVCGLFARRAFNVEGILCLPIQDSDKSHIWLLVNDDQRLEQMI
SQIDKLEDVVKVQRNQSDPTMFNKIAVFFQ
Structure information
PDB ID 5ypp (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of IlvN.Val-1a
Assembly ID 2
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 94
Sequence identity between the two chains 1.0
PubMed citation 30887800
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession P0ADF8 P0ADF8
Species 83333 (Escherichia coli K-12) 83333 (Escherichia coli K-12)
Function annotation BioLiP:5yppC BioLiP:5yppD
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5ypp-a2-m1-cC_5ypp-a2-m1-cD.pdb.gz
Full biological assembly
Download: 5ypp-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2lvw/1/1:A/1:B 5ypp/1/1:A/1:B 5ypp/3/1:F/1:E 5ypw/1/1:A/1:B 5ypw/2/1:C/1:D 5ypw/3/1:E/1:F 5ypw/4/1:G/1:H 5ypy/1/1:B/1:A 5ypy/2/1:D/1:C 5yum/1/1:A/2:A

[Back to Home]