5ytq/2/1:C/2:C

Sequences
>5ytq-a2-m1-cC (length=66) [Search sequence]
KKRLQVVISEEQDALLTRAAYALSSPERAVSKSEVVRLAIEKIARELEEGKAKEELEALL
KHLKAE
>5ytq-a2-m2-cC (length=66) [Search sequence]
KKRLQVVISEEQDALLTRAAYALSSPERAVSKSEVVRLAIEKIARELEEGKAKEELEALL
KHLKAE
Structure information
PDB ID 5ytq (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of TTHA0139 L34A with Lanthanum from Thermus thermophilus HB8
Assembly ID 2
Resolution 2.393Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 146
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID C C
UniProt accession Q5SM04 Q5SM04
Species 300852 (Thermus thermophilus HB8) 300852 (Thermus thermophilus HB8)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5ytq-a2-m1-cC_5ytq-a2-m2-cC.pdb.gz
Full biological assembly
Download: 5ytq-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5ytp/1/1:B/1:A 5ytq/1/1:B/1:A

[Back to Home]