5yuf/1/1:D/1:A

Sequences
>5yuf-a1-m1-cD (length=46) [Search sequence]
EFQFLRCQQCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWP
>5yuf-a1-m1-cA (length=47) [Search sequence]
EFQFLRCQQCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPL
Structure information
PDB ID 5yuf (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of PML RING tetramer
Assembly ID 1
Resolution 1.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 34
Sequence identity between the two chains 1.0
PubMed citation 29599493
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D A
UniProt accession P29590 P29590
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:5yufD BioLiP:5yufA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5yuf-a1-m1-cD_5yuf-a1-m1-cA.pdb.gz
Full biological assembly
Download: 5yuf-assembly1.cif.gz
Similar dimers

[Back to Home]