5yug/2/1:B/1:E

Sequences

>5yug-a2-m1-cB (length=92) [Search sequence]

SKMCMNASCGTTSTVEWKKGWPLRSGLLADLCYRCGSAYESSLFCEQFHKDQSGWRECYL CSKRLHCGCIASKVTIELMDYGGVGCSTCACC

>5yug-a2-m1-cE (length=102) [Search sequence]

KMCMNASCGTTSTVEWKKGWPLRSGLLADLCYRCGSAYESSLFCEQFHKDQSGWRECYLC SKRLHCGCIASKVTIELMDYGGVGCSTCACCHQLNLNTRGEN

Structure information

PDB ID	5yug (database links: RCSB PDB PDBe PDBj PDBsum)
Title	AtVAL1 PHD-Like domain in the P31 space group
Assembly ID	2
Resolution	1.57Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	96
Sequence identity between the two chains	0.989
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	E
UniProt accession	Q8W4L5	Q8W4L5
Species	3702 (Arabidopsis thaliana)	3702 (Arabidopsis thaliana)
Function annotation	BioLiP:5yugB	BioLiP:5yugE

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5yug-a2-m1-cB_5yug-a2-m1-cE.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5yug-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

5yug/1/2:A/1:G 5yuh/1/1:A/2:A