5z81/1/1:B/1:C

Sequences
>5z81-a1-m1-cB (length=99) [Search sequence]
EEVRLDKWLWAARFYKTRSLARNMVEGGKVHYNGQRAKPSKSVEIGAQITLRQGHDEKTI
IIEKISDQRRGAPEAQQLYRETAKSITKRERNAMMRQLN
>5z81-a1-m1-cC (length=99) [Search sequence]
EEVRLDKWLWAARFYKTRSLARNMVEGGKVHYNGQRAKPSKSVEIGAQITLRQGHDEKTI
IIEKISDQRRGAPEAQQLYRETAKSITKRERNAMMRQLN
Structure information
PDB ID 5z81 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Trimeric structure of Vibrio cholerae Heat Shock Protein 15 at 2.3 Angstrom resolution
Assembly ID 1
Resolution 2.334Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 23
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession A0A0H3AM46 A0A0H3AM46
Species 345073 (Vibrio cholerae O395) 345073 (Vibrio cholerae O395)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5z81-a1-m1-cB_5z81-a1-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 5z81-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5z81/1/1:A/1:B 5z81/1/1:A/1:C

[Back to Home]