5zbx/1/1:A/1:E

Sequences
>5zbx-a1-m1-cA (length=95) [Search sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREICQDFTDFNWQAQALLALQEAAEA
FLVHLFEDAYLLTLHAKRVTIMPKDIQLARRIRGE
>5zbx-a1-m1-cE (length=101) [Search sequence]
VKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREICQDFTRGVDFNWQAQALLAL
QEAAEAFLVHLFEDAYLLTLHAKRVTIMPKDIQLARRIRGE
Structure information
PDB ID 5zbx (database links: RCSB PDB PDBe PDBj PDBsum)
Title The crystal structure of the nucleosome containing histone H3.1 CATD(V76Q, K77D)
Assembly ID 1
Resolution 2.58Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 34
Sequence identity between the two chains 1.0
PubMed citation 30718488
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A E
UniProt accession P68431 P68431
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:5zbxA BioLiP:5zbxE
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5zbx-a1-m1-cA_5zbx-a1-m1-cE.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 5zbx-assembly1.cif.gz
Similar dimers

[Back to Home]