5zg9/1/2:B/2:A

Sequences
>5zg9-a1-m2-cB (length=82) [Search sequence]
SNPGGSQVDAEGNPFWEISDKRRVGISQFKKMDFINIREYYEAGGEMKPGKKGIGLTVDQ
YTAFLKAIPAINAELRSRGHDI
>5zg9-a1-m2-cA (length=83) [Search sequence]
SNPGGSQVDAEGNPFWEISDKRRVGISQFKKMDFINIREYYEAGGEMKPGKKGIGLTVDQ
YTAFLKAIPAINAELRSRGHDIT
Structure information
PDB ID 5zg9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of MoSub1-ssDNA complex in phosphate buffer
Assembly ID 1
Resolution 2.04Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 112
Sequence identity between the two chains 1.0
PubMed citation 30561148
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID B A
UniProt accession L7IX95 L7IX95
Species 1143193 (Pyricularia oryzae P131) 1143193 (Pyricularia oryzae P131)
Function annotation BioLiP:5zg9A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5zg9-a1-m2-cB_5zg9-a1-m2-cA.pdb.gz
Full biological assembly
Download: 5zg9-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4agh/1/1:A/2:A 4bhm/1/1:B/1:A 4bhm/1/1:D/1:C 4bhm/1/1:E/1:F 5zg9/1/1:B/1:A

[Back to Home]