5zi6/4/1:G/1:H

Sequences
>5zi6-a4-m1-cG (length=55) [Search sequence]
KHDCVICFENEVIAALVPCGHNLFCMECANKICEKRTPSCPVCQTAVTQAIQIHS
>5zi6-a4-m1-cH (length=55) [Search sequence]
KHDCVICFENEVIAALVPCGHNLFCMECANKICEKRTPSCPVCQTAVTQAIQIHS
Structure information
PDB ID 5zi6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title The RING domain structure of MEX-3C
Assembly ID 4
Resolution 2.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 46
Sequence identity between the two chains 1.0
PubMed citation 30095198
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID G H
UniProt accession Q5U5Q3 Q5U5Q3
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:5zi6G BioLiP:5zi6H
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5zi6-a4-m1-cG_5zi6-a4-m1-cH.pdb.gz
Full biological assembly
Download: 5zi6-assembly4.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5zi6/1/1:A/1:B 5zi6/2/1:C/1:D 5zi6/3/1:E/1:F

[Back to Home]