5zi8/1/1:B/1:A

Sequences
>5zi8-a1-m1-cB (length=103) [Search sequence]
AMDPEFMREFQRAAVRLHILHHAADNEVHGAWLTQELSRHGYRVSPGTLYPTLHRLEADG
LLVSEQRVVDGRARRVYRATPAGRAALTEDRRALEELAREVLQ
>5zi8-a1-m1-cA (length=104) [Search sequence]
AMDPEFMREFQRAAVRLHILHHAADNEVHGAWLTQELSRHGYRVSPGTLYPTLHRLEADG
LLVSEQRVVDGRARRVYRATPAGRAALTEDRRALEELAREVLGH
Structure information
PDB ID 5zi8 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the PadR-family transcriptional regulator Rv3488 of Mycobacterium tuberculosis H37Rv in complex with cadmium ion
Assembly ID 1
Resolution 2.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 111
Sequence identity between the two chains 0.99
PubMed citation 30266832
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession I6X7F9 I6X7F9
Species 83332 (Mycobacterium tuberculosis H37Rv) 83332 (Mycobacterium tuberculosis H37Rv)
Function annotation BioLiP:5zi8B BioLiP:5zi8A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5zi8-a1-m1-cB_5zi8-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 5zi8-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5zhc/1/1:A/1:B 5zhv/1/1:A/1:B 7wh4/1/1:A/1:B

[Back to Home]