5zko/1/1:A/1:C

Sequences
>5zko-a1-m1-cA (length=53) [Search sequence]
KREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYC
>5zko-a1-m1-cC (length=53) [Search sequence]
KREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYC
Structure information
PDB ID 5zko (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the CRTC2-CREB-CRE complex
Assembly ID 1
Resolution 3.05Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 36
Sequence identity between the two chains 1.0
PubMed citation 29733854
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A C
UniProt accession P16220 P16220
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:5zkoA BioLiP:5zkoC
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5zko-a1-m1-cA_5zko-a1-m1-cC.pdb.gz
Full biological assembly
Download: 5zko-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1dh3/1/1:A/1:C 5zk1/1/1:A/2:A

[Back to Home]