6a9c/1/1:A/1:B

Sequences
>6a9c-a1-m1-cA (length=59) [Search sequence]
MSKLPQVKALYPYTAANDEELSFKVGDIITILEKDEGWWKGELNGQEGWIPNNYVKEIL
>6a9c-a1-m1-cB (length=66) [Search sequence]
MSKLPQVKALYPYTAANDEELSFKVGDIITILEKDEGWWKGELNGQEGWIPNNYVKEILE
HHHHHH
Structure information
PDB ID 6a9c (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure c-terminal SH3 domain of Myosin IB from Entamoeba histolytica bound to EhFP10(GEF) peptide.
Assembly ID 1
Resolution 1.98Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 50
Sequence identity between the two chains 1.0
PubMed citation 30779788
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession C4LUC7 C4LUC7
Species 5759 (Entamoeba histolytica) 5759 (Entamoeba histolytica)
Function annotation BioLiP:6a9cB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6a9c-a1-m1-cA_6a9c-a1-m1-cB.pdb.gz
Full biological assembly
Download: 6a9c-assembly1.cif.gz

[Back to Home]