6a9p/1/1:H/1:A

Sequences

>6a9p-a1-m1-cH (length=101) [Search sequence]

HMTKLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETNLRLEAEN NLAAYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEV

>6a9p-a1-m1-cA (length=103) [Search sequence]

TKLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNL AAYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEVRELQ

Structure information

PDB ID	6a9p (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the human glial fibrillary acidic protein 1B domain
Assembly ID	1
Resolution	2.51Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	21
Sequence identity between the two chains	0.98

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	H	A
UniProt accession	P14136	P14136
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6a9p-a1-m1-cH_6a9p-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 6a9p-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	6a9p/1/1:B/1:G 6a9p/2/1:E/1:D 6a9p/2/1:F/1:C
Other dimers with similar sequences but different poses	6a9p/2/1:F/1:E 6a9p/1/1:A/1:B 6a9p/1/1:H/1:G 6a9p/2/1:C/1:D 6a9p/2/1:E/1:C 6a9p/1/1:A/1:G