6a9p/2/1:F/1:E

Sequences

>6a9p-a2-m1-cF (length=100) [Search sequence]

MTKLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENN LAAYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEV

>6a9p-a2-m1-cE (length=102) [Search sequence]

TKLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNL AAYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEVREL

Structure information

PDB ID	6a9p (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the human glial fibrillary acidic protein 1B domain
Assembly ID	2
Resolution	2.51Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	145
Sequence identity between the two chains	0.99

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	F	E
UniProt accession	P14136	P14136
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 6a9p-a2-m1-cF_6a9p-a2-m1-cE.pdb.gz

Full biological assembly Download: 6a9p-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures	6a9p/1/1:A/1:B 6a9p/1/1:H/1:G 6a9p/2/1:C/1:D
Other dimers with similar sequences but different poses	6a9p/2/1:E/1:C 6a9p/1/1:A/1:G 6a9p/1/1:H/1:A 6a9p/1/1:B/1:G 6a9p/2/1:E/1:D 6a9p/2/1:F/1:C