6ahx/1/1:A/2:A

Sequences
>6ahx-a1-m1-cA (length=60) [Search sequence]
KYRKQVINRLARIEGHVRAIKEMAAEGRDCPDILLQIAAVRKALDSTAKVIFADHMESCL
>6ahx-a1-m2-cA (length=60) [Search sequence]
KYRKQVINRLARIEGHVRAIKEMAAEGRDCPDILLQIAAVRKALDSTAKVIFADHMESCL
Structure information
PDB ID 6ahx (database links: RCSB PDB PDBe PDBj PDBsum)
Title Copper-Sensing Operon Regulator Protein (CsoRGz)
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 86
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession S7SWX2 S7SWX2
Species 213419 (Geobacillus zalihae) 213419 (Geobacillus zalihae)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6ahx-a1-m1-cA_6ahx-a1-m2-cA.pdb.gz
Full biological assembly
Download: 6ahx-assembly1.cif.gz

[Back to Home]