6akk/1/2:B/1:A

Sequences
>6akk-a1-m2-cB (length=48) [Search sequence]
GLLSQENTQIRDLQQENRELWISLEEHQDALELIMSKYRKQMLQLMVA
>6akk-a1-m1-cA (length=49) [Search sequence]
GLLSQENTQIRDLQQENRELWISLEEHQDALELIMSKYRKQMLQLMVAK
Structure information
PDB ID 6akk (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the second Coiled-coil domain of SIKE1
Assembly ID 1
Resolution 1.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 22
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 1
Chain ID B A
UniProt accession Q9BRV8 Q9BRV8
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6akk-a1-m2-cB_6akk-a1-m1-cA.pdb.gz
Full biological assembly
Download: 6akk-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 6akk/1/1:B/2:B 6akk/1/1:A/2:A
  • 6akk/1/2:B/2:A 6akk/1/1:B/1:A
  • [Back to Home]