6akl/1/1:B/1:A

Sequences

>6akl-a1-m1-cB (length=47) [Search sequence]

LSQENTQIRDLQQENRELWISLEEHQDALELIMSKYRKQMLQLMVAK

>6akl-a1-m1-cA (length=52) [Search sequence]

STMALLSQENTQIRDLQQENRELWISLEEHQDALELIMSKYRKQMLQLMVAK

Structure information

PDB ID	6akl (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of Striatin3 in complex with SIKE1 Coiled-coil domain
Assembly ID	1
Resolution	1.75Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	66
Sequence identity between the two chains	1.0
PubMed citation	30622739

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	Q9BRV8	Q9BRV8
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:6aklB	BioLiP:6aklA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 6akl-a1-m1-cB_6akl-a1-m1-cA.pdb.gz

Full biological assembly Download: 6akl-assembly1.cif.gz