6atl/3/1:C/1:A

Sequences
>6atl-a3-m1-cC (length=36) [Search sequence]
SVVIGQRCYRSPDCYSACKKLVGKATGKCTNGRCDC
>6atl-a3-m1-cA (length=37) [Search sequence]
GSVVIGQRCYRSPDCYSACKKLVGKATGKCTNGRCDC
Structure information
PDB ID 6atl (database links: RCSB PDB PDBe PDBj PDBsum)
Title Exploring Cystine Dense Peptide Space to Open a Unique Molecular Toolbox
Assembly ID 3
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 30
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C A
UniProt accession P56219 P56219
Species 6887 (Tityus serrulatus) 6887 (Tityus serrulatus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6atl-a3-m1-cC_6atl-a3-m1-cA.pdb.gz
Full biological assembly
Download: 6atl-assembly3.cif.gz

[Back to Home]