6aty/3/1:A/6:A

Sequences
>6aty-a3-m1-cA (length=38) [Search sequence]
SISIGIKCSPSIDLCEGQCRIRKYFTGYCSGDTCHCSG
>6aty-a3-m6-cA (length=38) [Search sequence]
SISIGIKCSPSIDLCEGQCRIRKYFTGYCSGDTCHCSG
Structure information
PDB ID 6aty (database links: RCSB PDB PDBe PDBj PDBsum)
Title Exploring Cystine Dense Peptide Space to Open a Unique Molecular Toolbox
Assembly ID 3
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 13
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 6
Chain ID A A
UniProt accession P0CJ17 P0CJ17
Species 172552 (Lychas mucronatus) 172552 (Lychas mucronatus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6aty-a3-m1-cA_6aty-a3-m6-cA.pdb.gz
Full biological assembly
Download: 6aty-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6aty/2/1:A/6:A 6aty/2/2:A/5:A 6aty/2/3:A/4:A
Other dimers with similar sequences but different poses
  • 6aty/2/2:A/6:A 6aty/2/1:A/4:A 6aty/2/3:A/5:A
  • [Back to Home]