6aw1/3/2:A/2:B

Sequences
>6aw1-a3-m2-cA (length=108) [Search sequence]
AKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGA
AYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVY
>6aw1-a3-m2-cB (length=108) [Search sequence]
AKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGA
AYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVY
Structure information
PDB ID 6aw1 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of CEACAM3
Assembly ID 3
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 69
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID A B
UniProt accession P40198 P40198
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6aw1-a3-m2-cA_6aw1-a3-m2-cB.pdb.gz
Full biological assembly
Download: 6aw1-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4y8a/1/1:A/1:B 6aw1/3/1:A/1:B
Other dimers with similar sequences but different poses
  • 6aw1/3/1:A/2:B 6aw1/3/1:B/2:A
  • [Back to Home]