6b8h/1/1:i/1:w

Sequences

>6b8h-a1-m1-ci (length=59) [Search sequence]

MLKRFPTPILKVYWPFFVAGAAVYYGMSKAADLSSNTKEFINDPRNPRFAKGGKFVEVD

>6b8h-a1-m1-cw (length=59) [Search sequence]

MLKRFPTPILKVYWPFFVAGAAVYYGMSKAADLSSNTKEFINDPRNPRFAKGGKFVEVD

Structure information

PDB ID	6b8h (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Mosaic model of yeast mitochondrial ATP synthase monomer
Assembly ID	1
Resolution	3.6Å
Method of structure determination	ELECTRON MICROSCOPY
Number of inter-chain contacts	15
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	i	w
UniProt accession	P81450	P81450
Species	559292 (Saccharomyces cerevisiae S288C)	559292 (Saccharomyces cerevisiae S288C)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6b8h-a1-m1-ci_6b8h-a1-m1-cw.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 6b8h-assembly1.cif.gz

Similar dimers