6bej/1/1:A/1:E

Sequences

>6bej-a1-m1-cA (length=201) [Search sequence]

AYTLPQLPYAYDALEPNIDAQTMEIHHTKHHQTYINNVNAALEGTEYADLPIEELVSKLK
SLPENLQGPVRNNGGGHANHSLFWTVLSPNGGGEPKGEVAKAIDKDLGGFEKFKEAFTKA
AVSRFGSGWAWLSVTPDKKLVVESTANQDSPLFEGNTPILGLDVWEHAYYLKYQNRRPEY
IGAFYNAVNWEEVERRYHAAI

>6bej-a1-m1-cE (length=201) [Search sequence]

Structure information

PDB ID	6bej (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of manganese superoxide dismutase from Xanthomonas citri
Assembly ID	1
Resolution	1.894Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	48
Sequence identity between the two chains	1.0
PubMed citation	30615696

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	E
UniProt accession	Q8PJZ1	Q8PJZ1
Species	346 (Xanthomonas citri)	346 (Xanthomonas citri)
Function annotation	BioLiP:6bejA	BioLiP:6bejE

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	6bej-a1-m1-cA_6bej-a1-m1-cE.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	6bej-assembly1.cif.gz