6bhx/1/1:A/1:C

Sequences

>6bhx-a1-m1-cA (length=98) [Search sequence]

GSHMLNRVVLVGRLTKDPELRYTPNGAAVATFTLAVNRTFTEADFINCVTWRRQAENVAN FLKKGSLAGVDGRLQTRNYGQRVFVTEVQAESVQFLEP

>6bhx-a1-m1-cC (length=102) [Search sequence]

GSHMLNRVVLVGRLTKDPELRYTPNGAAVATFTLAVNRTFREADFINCVTWRRQAENVAN FLKKGSLAGVDGRLQTRNYENQQGQRVFVTEVQAESVQFLEP

Structure information

PDB ID	6bhx (database links: RCSB PDB PDBe PDBj PDBsum)
Title	B. subtilis SsbA with DNA
Assembly ID	1
Resolution	2.936Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	24
Sequence identity between the two chains	0.99
PubMed citation	30472092

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	C
UniProt accession	P37455	P37455
Species	224308 (Bacillus subtilis subsp. subtilis str. 168)	224308 (Bacillus subtilis subsp. subtilis str. 168)
Function annotation	BioLiP:6bhxA	BioLiP:6bhxC

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 6bhx-a1-m1-cA_6bhx-a1-m1-cC.pdb.gz

Full biological assembly Download: 6bhx-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	6bhw/1/1:B/1:C 6bhw/2/1:F/1:G
Other dimers with similar sequences but different poses	6bhw/2/1:F/1:E 6bhw/1/1:D/1:C 6bhx/1/1:B/1:C