6bjo/1/1:B/1:A

Sequences
>6bjo-a1-m1-cB (length=85) [Search sequence]
VPGKVTLQKDAQNLIGISIGGGAYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIK
GKTKVEVAKMIQEVKGEVTIHYNKL
>6bjo-a1-m1-cA (length=86) [Search sequence]
VPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSI
KGKTKVEVAKMIQEVKGEVTIHYNKL
Structure information
PDB ID 6bjo (database links: RCSB PDB PDBe PDBj PDBsum)
Title PICK1 PDZ domain in complex with the small molecule inhibitor BIO124.
Assembly ID 1
Resolution 1.75Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 35
Sequence identity between the two chains 1.0
PubMed citation 29280296
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession Q9NRD5 Q9NRD5
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:6bjoB BioLiP:6bjoA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6bjo-a1-m1-cB_6bjo-a1-m1-cA.pdb.gz
Full biological assembly
Download: 6bjo-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2gzv/2/1:A/2:A 6ar4/1/1:A/1:B 6bjn/1/1:A/1:B
Other dimers with similar sequences but different poses
  • 3hpk/3/1:B/1:A 3hpm/3/1:A/1:B
  • [Back to Home]