6bsy/1/1:B/1:A

Sequences
>6bsy-a1-m1-cB (length=55) [Search sequence]
DLLKAVRLIKFLYQSNPPPNPEGTRQARRNRRRRWRERQRQIHSISERILSTYLG
>6bsy-a1-m1-cA (length=58) [Search sequence]
SDEDLLKAVRLIKFLYQSNPPPNPEGTRQARRNRRRRWRERQRQIHSISERILSTYLG
Structure information
PDB ID 6bsy (database links: RCSB PDB PDBe PDBj PDBsum)
Title HIV-1 Rev assembly domain (residues 1-69)
Assembly ID 1
Resolution 2.25Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 33
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession P04616 P04616
Species 11676 (Human immunodeficiency virus 1) 11676 (Human immunodeficiency virus 1)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6bsy-a1-m1-cB_6bsy-a1-m1-cA.pdb.gz
Full biological assembly
Download: 6bsy-assembly1.cif.gz

[Back to Home]