6bx3/1/1:N/1:M

Sequences
>6bx3-a1-m1-cN (length=40) [Search sequence]
TRKYLNTNVTPHLLAGMRLIAVQQPEDPLRVLGEYLIEQS
>6bx3-a1-m1-cM (length=42) [Search sequence]
TRKYLNTNVTPHLLAGMRLIAVQQPEDPLRVLGEYLIEQSNI
Structure information
PDB ID 6bx3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of histone H3k4 methyltransferase
Assembly ID 1
Resolution 4.3Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 52
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID N M
UniProt accession Q03323 Q03323
Species 559292 (Saccharomyces cerevisiae S288C) 559292 (Saccharomyces cerevisiae S288C)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6bx3-a1-m1-cN_6bx3-a1-m1-cM.pdb.gz
Full biological assembly
Download: 6bx3-assembly1.cif.gz

[Back to Home]