6c0y/4/1:D/1:H

Sequences

>6c0y-a4-m1-cD (length=108) [Search sequence]

DVDIIRRIQELMVLCSLLPPDGKLREALELALALHEEPALARITPLTNLHPFATKAWLET LWLGEGVSSEEKELVAWQNKSENMGPAIRELKNAEQQSGITLVARLTS

>6c0y-a4-m1-cH (length=108) [Search sequence]

DVDIIRRIQELMVLCSLLPPDGKLREALELALALHEEPALARITPLTNLHPFATKAWLET LWLGEGVSSEEKELVAWQNKSENMGPAIRELKNAEQQSGITLVARLTS

Structure information

PDB ID	6c0y (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Lysinoalanine synthase, DurN, from duramycin biosynthesis bound to duramycin
Assembly ID	4
Resolution	1.66Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	201
Sequence identity between the two chains	1.0
PubMed citation	30177849

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	H
UniProt accession	A0A3F2YLX1	A0A3F2YLX1
Species	53446 (Streptomyces cinnamoneus)	53446 (Streptomyces cinnamoneus)
Function annotation	BioLiP:6c0yD	BioLiP:6c0yH

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6c0y-a4-m1-cD_6c0y-a4-m1-cH.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 6c0y-assembly4.cif.gz

Similar dimers

Other dimers with similar sequences and structures

6c0g/1/1:A/2:B 6c0h/1/1:B/1:A 6c0y/1/1:A/1:E 6c0y/2/1:B/1:F 6c0y/3/1:C/1:G