6cn8/1/1:B/1:A

Sequences

>6cn8-a1-m1-cB (length=2) [Search sequence]

AL

>6cn8-a1-m1-cA (length=152) [Search sequence]

MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLESLGISLEGVR SQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA AQVLVKLGAELTRVRQQVIQLLSGYKLAAALE

Structure information

PDB ID	6cn8 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	High-resolution structure of ClpC1-NTD binding to Rufomycin-I
Assembly ID	1
Resolution	1.4Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	11
Sequence identity between the two chains	1.0
PubMed citation	30990022

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession		P9WPC9
Species	1893 (Streptomyces atratus)	1773 (Mycobacterium tuberculosis)
Function annotation	BioLiP:6cn8A

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6cn8-a1-m1-cB_6cn8-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 6cn8-assembly1.cif.gz