6cqo/1/1:G/1:A

Sequences

>6cqo-a1-m1-cG (length=87) [Search sequence]

DFSKSIVGRIGSEFTEHYLKYSIASQPRRDGQTNWYNITVFNEPQINFLTEYVRKGALVY VEADAANYVFGTTLSLVQKDINLLKNG

>6cqo-a1-m1-cA (length=93) [Search sequence]

DFSKSIVGRIGSEFTEHTSANNRYLKYSIASQPRRDGQTNWYNITVFNEPQINFLTEYVR KGALVYVEADAANYVGTTLSLVQKDINLLKNGK

Structure information

PDB ID	6cqo (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of mitochondrial single-stranded DNA binding proteins from S. cerevisiae (SeMet Labeled), Rim1 (Form2)
Assembly ID	1
Resolution	2.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	67
Sequence identity between the two chains	0.989

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	G	A
UniProt accession	P32445	P32445
Species	559292 (Saccharomyces cerevisiae S288C)	559292 (Saccharomyces cerevisiae S288C)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6cqo-a1-m1-cG_6cqo-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 6cqo-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

6cqm/1/1:G/1:A 6cqm/2/3:H/1:E 6cqo/4/2:H/1:E