6cum/1/1:A/2:A

Sequences
>6cum-a1-m1-cA (length=51) [Search sequence]
DTPERRRARARSQILSLAQTLLRNHADLDRLSAAVADGSSDAYTAAERLFA
>6cum-a1-m2-cA (length=51) [Search sequence]
DTPERRRARARSQILSLAQTLLRNHADLDRLSAAVADGSSDAYTAAERLFA
Structure information
PDB ID 6cum (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a C-terminal proteolytic fragment of a protein annotated as an LAO/AO transport system ATPase but likely MeaB and MMAA-like GTPase from Mycobacterium smegmatis
Assembly ID 1
Resolution 1.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 101
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession A0R1T8 A0R1T8
Species 246196 (Mycolicibacterium smegmatis MC2 155) 246196 (Mycolicibacterium smegmatis MC2 155)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6cum-a1-m1-cA_6cum-a1-m2-cA.pdb.gz
Full biological assembly
Download: 6cum-assembly1.cif.gz

[Back to Home]