6d4n/1/1:A/1:B

Sequences

>6d4n-a1-m1-cA (length=208) [Search sequence]

GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAQTKPRERQF
NSTYRVVSVLTVTHQDWLNGKEYTCKVSNKGLPAPIEKTISKAKGQPREPQVYILPPPQE
ELTKNQVSLTCLVTGFYPSDIAVEWESNGQPENTYKTTPPVLDSDGSYLLYSKLTVNKSR
WQPGNIFTCSVMHEALHNHYTQKSLSVS

>6d4n-a1-m1-cB (length=208) [Search sequence]

Structure information

PDB ID	6d4n (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of a Fc fragment of Rhesus macaque (Macaca mulatta) IgG4
Assembly ID	1
Resolution	3.25Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	64
Sequence identity between the two chains	1.0
PubMed citation	30939981

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession
Species	9544 (Macaca mulatta)	9544 (Macaca mulatta)
Function annotation	BioLiP:6d4nA

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	6d4n-a1-m1-cA_6d4n-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	6d4n-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

5hvw/1/2:A/6:A 5hvw/1/1:A/4:A 5hvw/1/3:A/5:A