6d6j/1/1:A/1:B

Sequences
>6d6j-a1-m1-cA (length=112) [Search sequence]
NCLFCKIAQGEIPATVVFEDKNILAFRDIRPQAPTHLLIIPKKHIATINDVNDDDSELLA
NILIRAKKLAQAEGLSEMGYRLVFNVNSGGGQEVYHIHLHLLGGRQMTWPPG
>6d6j-a1-m1-cB (length=112) [Search sequence]
MNCLFCKIAQGEIPATVVFEDKNILAFRDIPQAPTHLLIIPKKHIATINDVNDDDSELLA
NILIRAKKLAQAEGLSEMGYRLVFNVNSGGGQEVYHIHLHLLGGRQMTWPPG
Structure information
PDB ID 6d6j (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of HIT family hydrolase from Legionella pneumophila Philadelphia 1
Assembly ID 1
Resolution 1.35Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 164
Sequence identity between the two chains 0.991
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q5ZRW1 Q5ZRW1
Species 272624 (Legionella pneumophila subsp. pneumophila str. Philadelphia 1) 272624 (Legionella pneumophila subsp. pneumophila str. Philadelphia 1)
Function annotation BioLiP:6d6jA BioLiP:6d6jB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6d6j-a1-m1-cA_6d6j-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 6d6j-assembly1.cif.gz

[Back to Home]