6d6j/1/1:A/1:B

Sequences

>6d6j-a1-m1-cA (length=112) [Search sequence]

NCLFCKIAQGEIPATVVFEDKNILAFRDIRPQAPTHLLIIPKKHIATINDVNDDDSELLA NILIRAKKLAQAEGLSEMGYRLVFNVNSGGGQEVYHIHLHLLGGRQMTWPPG

>6d6j-a1-m1-cB (length=112) [Search sequence]

MNCLFCKIAQGEIPATVVFEDKNILAFRDIPQAPTHLLIIPKKHIATINDVNDDDSELLA NILIRAKKLAQAEGLSEMGYRLVFNVNSGGGQEVYHIHLHLLGGRQMTWPPG

Structure information

PDB ID	6d6j (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of HIT family hydrolase from Legionella pneumophila Philadelphia 1
Assembly ID	1
Resolution	1.35Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	164
Sequence identity between the two chains	0.991
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q5ZRW1	Q5ZRW1
Species	272624 (Legionella pneumophila subsp. pneumophila str. Philadelphia 1)	272624 (Legionella pneumophila subsp. pneumophila str. Philadelphia 1)
Function annotation	BioLiP:6d6jA	BioLiP:6d6jB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6d6j-a1-m1-cA_6d6j-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 6d6j-assembly1.cif.gz