6deb/1/1:A/1:B

Sequences

>6deb-a1-m1-cA (length=284) [Search sequence]

NAMTLLDGKALSAKIKEELKEKNQFLKSKGIESCLAVILVGDNPASQTYVKSKAKACEEC
GIKSLVYHLNENITQNELLALINTLNHDDSVHGILVQLPLPDHICKDLILESIISSKDVD
GFHPINVGYLNLGLESGFLPCTPLGVMKLLKAYEIDLEGKDAVIIGASNIVGRPMATMLL
NAGATVSVCHIKTKDLSLYTRQADLIIVAAGCVNLLRSDMVKEGVIVVDVGINRLESGKI
VGDVDFEEVSKKSSYITPVPGGVGPMTIAMLLENTVKSAKNRLN

>6deb-a1-m1-cB (length=284) [Search sequence]

Structure information

PDB ID	6deb (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of Bifunctional Enzyme FolD-Methylenetetrahydrofolate Dehydrogenase/Cyclohydrolase in the Complex with Methotrexate from Campylobacter jejuni
Assembly ID	1
Resolution	1.7Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	92
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q0PA35	Q0PA35
Species	192222 (Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819)	192222 (Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819)
Function annotation	BioLiP:6debB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	6deb-a1-m1-cA_6deb-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	6deb-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3p2o/1/1:B/1:A 6de8/1/1:A/1:B 6de8/2/1:A/1:B 6de8/2/2:A/2:B