6dm4/2/1:C/1:D

Sequences

>6dm4-a2-m1-cC (length=119) [Search sequence]

SEKIYKVMEEIFVDRHYKENIRTGEEVKQYFSKSKAEFILRWSSANESDTENKYVFIAAS FQASDGIHSIRYGINKNGELFSINTASNKVTPIDILPLGVMATLTQHITQNKELIEKAL

>6dm4-a2-m1-cD (length=119) [Search sequence]

SEKIYKVMEEIFVDRHYKENIRTGEEVKQYFSKSKAEFILRWSSANESDTENKYVFIAAS FQASDGIHSIRYGINKNGELFSINTASNKVTPIDILPLGVMATLTQHITQNKELIEKAL

Structure information

PDB ID	6dm4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the SH2 domain from RavO (Lpg1129) from Legionella pneumophila in complex with Homo sapiens Shc1 phospho-Tyr317 peptide
Assembly ID	2
Resolution	1.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	36
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	Q5ZWF6	Q5ZWF6
Species	272624 (Legionella pneumophila subsp. pneumophila str. Philadelphia 1)	272624 (Legionella pneumophila subsp. pneumophila str. Philadelphia 1)
Function annotation	BioLiP:6dm4C	BioLiP:6dm4D

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 6dm4-a2-m1-cC_6dm4-a2-m1-cD.pdb.gz

Full biological assembly Download: 6dm4-assembly2.cif.gz

Similar dimers