6ds6/1/1:A/2:A

Sequences
>6ds6-a1-m1-cA (length=53) [Search sequence]
ARTKQTQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLG
>6ds6-a1-m2-cA (length=53) [Search sequence]
ARTKQTQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLG
Structure information
PDB ID 6ds6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of p300 ZZ domain in complex with histone H3 peptide
Assembly ID 1
Resolution 1.95Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 54
Sequence identity between the two chains 1.0
PubMed citation 30150647
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession Q09472 Q09472
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:6ds6A BioLiP:6ds6A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6ds6-a1-m1-cA_6ds6-a1-m2-cA.pdb.gz
Full biological assembly
Download: 6ds6-assembly1.cif.gz

[Back to Home]