6dvu/1/1:A/2:B

Sequences
>6dvu-a1-m1-cA (length=51) [Search sequence]
SSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKI
>6dvu-a1-m2-cB (length=53) [Search sequence]
DVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKI
Structure information
PDB ID 6dvu (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the Monoclinic-1 (Monocl-1) Crystal Form of Human Apolipoprotein C1
Assembly ID 1
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 49
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A B
UniProt accession P02654 P02654
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6dvu-a1-m1-cA_6dvu-a1-m2-cB.pdb.gz
Full biological assembly
Download: 6dvu-assembly1.cif.gz
Similar dimers

[Back to Home]