6e2j/2/2:B/4:B

Sequences

>6e2j-a2-m2-cB (length=104) [Search sequence]

GSDYSKYYKTIDDLKNQILNLTTDNANILLQIDNARLAADDFRLKYENEVALRQSVEADI NGLRRVLDELTLTKADLEMQIESLTEELAYLKKNHEEEMKDLRN

>6e2j-a2-m4-cB (length=104) [Search sequence]

GSDYSKYYKTIDDLKNQILNLTTDNANILLQIDNARLAADDFRLKYENEVALRQSVEADI NGLRRVLDELTLTKADLEMQIESLTEELAYLKKNHEEEMKDLRN

Structure information

PDB ID	6e2j (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the heterocomplex between human keratin 1 coil 1B containing S233L mutation and wild-type human keratin 10 coil 1B
Assembly ID	2
Resolution	2.386Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	13
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	2	4
Chain ID	B	B
UniProt accession	P13645	P13645
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6e2j-a2-m2-cB_6e2j-a2-m4-cB.pdb.gz

Full biological assembly Download: 6e2j-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

6e2j/1/1:B/3:B 6e2j/2/1:B/3:B