6eki/4/1:C/1:E

Sequences

>6eki-a4-m1-cC (length=222) [Search sequence]

HWSYHGETGPQHWGDLKNEYIMCKIGKNQSPVDISRIVEAELEKIKINYSSGGSSITNNG
HTIKVSYEPGSYIIVDGIRFELKQFHFHAPSEHTIKGKSYPFEAHFVHADKDGNLAVIGV
IFKEGKKNPIIEKIWENLPEAGKTIKLAHKINAYDLLPKKKKYYRYSGSLTTPPCSEGVR
WIVMEEEMELSKEQIEKFRKLMGGDTNRPVQPLNARMIMEMD

>6eki-a4-m1-cE (length=222) [Search sequence]

Structure information

PDB ID	6eki (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of a hyperthermostable carbonic anhydrase identified from an active hydrothermal vent chimney
Assembly ID	4
Resolution	2.555Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	78
Sequence identity between the two chains	1.0
PubMed citation	29685353

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	E
UniProt accession
Species	309805 (Persephonella marina)	309805 (Persephonella marina)
Function annotation	BioLiP:6ekiC	BioLiP:6ekiE

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	6eki-a4-m1-cC_6eki-a4-m1-cE.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	6eki-assembly4.cif.gz

Similar dimers

Other dimers with similar sequences and structures

6eki/1/1:D/2:A 6eki/2/1:A/3:D 6eki/3/1:B/1:F