6ezx/1/1:B/1:A

Sequences

>6ezx-a1-m1-cB (length=215) [Search sequence]

APRSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQ
GNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDTGFVDIPKQEK
ALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLVVGYGFENNKYWLV
KNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV

>6ezx-a1-m1-cA (length=217) [Search sequence]

Structure information

PDB ID	6ezx (database links: RCSB PDB PDBe PDBj PDBsum)
Title	CATHEPSIN L IN COMPLEX WITH (3S,14E)-19-chloro-N-(1-cyanocyclopropyl)-5-oxo-17-oxa-4-azatricyclo[16.2.2.06,11]docosa-1(21),6,8,10,14,18(22),19-heptaene-3-carboxamide
Assembly ID	1
Resolution	2.34Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	32
Sequence identity between the two chains	1.0
PubMed citation	29590750

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	P07711	P07711
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:6ezxB	BioLiP:6ezxA

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	6ezx-a1-m1-cB_6ezx-a1-m1-cA.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	6ezx-assembly1.cif.gz