6f1k/1/12:A/3:A

Sequences
>6f1k-a1-m12-cA (length=119) [Search sequence]
KAPVDPECTAKVGKAHVYCEGNDVYDVMLNQTNLQFNNNKYYLIQLLEDDAQRNFSVWMR
WGRVGKMGQHSLVACSGNLNKAKEIFQKKFLDKTKNNWEDREKFEKVPGKYDMLQMDYA
>6f1k-a1-m3-cA (length=119) [Search sequence]
KAPVDPECTAKVGKAHVYCEGNDVYDVMLNQTNLQFNNNKYYLIQLLEDDAQRNFSVWMR
WGRVGKMGQHSLVACSGNLNKAKEIFQKKFLDKTKNNWEDREKFEKVPGKYDMLQMDYA
Structure information
PDB ID 6f1k (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of ARTD2/PARP2 WGR domain bound to double strand DNA without 5'phosphate
Assembly ID 1
Resolution 2.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 66
Sequence identity between the two chains 1.0
PubMed citation 30321391
Chain information
Chain 1 Chain 2
Model ID 12 3
Chain ID A A
UniProt accession Q9UGN5 Q9UGN5
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:6f1kA BioLiP:6f1kA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6f1k-a1-m12-cA_6f1k-a1-m3-cA.pdb.gz
Full biological assembly
Download: 6f1k-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6f1k/1/10:A/2:A 6f1k/1/1:A/11:A

[Back to Home]